G54417MJ

From GPTWiki
Revision as of 17:41, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G54417MJ |class=N-Glycan |mw=2645.95706684 |name=H6N6FS FA4G3S A4G3FS HexNAc(6)Hex(6)dHex(1)NeuAc(1) HexNAc(6)Hex(6)Fuc(1)NeuAc(1) |nneuac=1 |sym=H6N6FS |t...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H6N6FS
FA4G3S
A4G3FS
HexNAc(6)Hex(6)dHex(1)NeuAc(1)
HexNAc(6)Hex(6)Fuc(1)NeuAc(1)
Molecular Weight 2645.95706684
Class(es) N-Glycan
GlyGen

G54417MJ

GNOme

G54417MJ

Topologies

Samples (Peptides)

SARS-CoV-2 Spike Protein (2 / 2)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001653K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A7,197.183P0DTC2N107440
PE001651R.EGVFVSN[H6N6FS]GTHWFVTQR.N4,508.863P0DTC2N109820