G49739MP

From GPTWiki
Revision as of 18:55, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G49739MP |class=N-Glycan |mw=2516.9144726 |name=H7N6F HexNAc(6)Hex(7)Fuc(1) HexNAc(6)Hex(7)dHex(1) |nneuac=0 |sym=H7N6F |topo=G43386RH,G91316EK |topo2=G047...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H7N6F
HexNAc(6)Hex(7)Fuc(1)
HexNAc(6)Hex(7)dHex(1)
Molecular Weight 2516.9144726
Class(es) N-Glycan
GlyGen

G49739MP

GNOme

G49739MP

Topologies

Samples (Peptides)

HEK293 Cells (1 / 4), Human Serum (1 / 4), SARS-CoV-2 Spike Protein (2 / 4)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE002176K.YTGN[H7N6F]ASALFILPDQDKMEEVEAMLLPETLK.R5,882.592P01011N27110
PE001617K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A7,068.140P0DTC2N107420
PE001521R.EGVFVSN[H7N6F]GTHWFVTQR.N4,379.821P0DTC2N109810
PE001879R.ALGFEN[H7N6F]ATQALGR.A3,863.609Q08380N6910