G41044JW

From GPTWiki
Revision as of 01:49, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G41044JW |class=N-Glycan |mw=3390.2007221 |name=H7N6FS3 HexNAc(6)Hex(7)Fuc(1)NeuAc(3) HexNAc(6)Hex(7)dHex(1)NeuAc(3) |nneuac=3 |sym=H7N6FS3 |topo=G12171MV,...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H7N6FS3
HexNAc(6)Hex(7)Fuc(1)NeuAc(3)
HexNAc(6)Hex(7)dHex(1)NeuAc(3)
Molecular Weight 3390.2007221
Class(es) N-Glycan
GlyGen

G41044JW

GNOme

G41044JW

Topologies

Samples (Peptides)

HEK293 Cells (1 / 11), Human Serum (7 / 11), SARS-CoV-2 Spike Protein (3 / 11)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001300K.EHEGAIYPDN[H7N6FS3]TTDFQR.A5,282.034P00450N13810
PE000814K.VVLHPN[H7N6FS3]YSQVDIGLIK.L5,184.205P00738N24110
PE000833K.SVQEIQATFFYFTPN[H7N6FS3]KTEDTIFLR.E6,284.650P02763N7240
PE000811K.SVQEIQATFFYFTPN[H7N6FS3]K.T5,309.147P02763N7210
PE001203R.QDQCIYN[H7N6FS3]TTYLNVQR.E5,305.090P02763N9320
PE000893R.ADGTVNQIEGEATPVN[H7N6FS3]LTEPAKLEVK.F6,112.603P05090N9820
PE001635K.VCEFQFCNDPFLGVYYHKNN[H7N6FS3]K.S6,068.405P0DTC2N14910
PE001546K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS3]FTTAPAICHDGK.A7,941.426P0DTC2N107410
PE001558K.NLN[H7N6FS3]ESLIDLQELGKYEQYIK.W5,799.443P0DTC2N119410
PE000811K.SVQEIQATFFYFTPN[H7N6FS3]K.T5,309.147P19652N7210
PE000833K.SVQEIQATFFYFTPN[H7N6FS3]KTEDTIFLR.E6,284.650P19652N7240
PE001857R.QNQCFYN[H7N6FS3]SSYLNVQR.E5,310.059P19652N9310
PE001898R.ALGFEN[H7N6FS3]ATQALGR.A4,736.895Q08380N6930