G39446WN

From GPTWiki
Revision as of 06:09, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G39446WN |class=N-Glycan |mw=1437.5127994 |name=H5N3 HexNAc(3)Hex(5) |nneuac=0 |sym=H5N3 |topo=G96175GI,G95925JP,G62371LC |topo2=G00336XG,G10331BX,G12413VK...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H5N3
HexNAc(3)Hex(5)
Molecular Weight 1437.5127994
Class(es) N-Glycan
GlyGen

G39446WN

GNOme

G39446WN

Topologies

Samples (Peptides)

Human ACE2 Protein (1 / 7), NIST IgG Standard (2 / 7), SARS-CoV-2 Spike Protein (4 / 7)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE000958R.EEQYN[H5N3]STYR.V2,626.018P01857N18030
PE000951K.TKPREEQYN[H5N3]STYR.V3,108.314P01857N18080
PE001571K.TQSLLIVNN[H5N3]ATNVVIK.V3,163.512P0DTC2N12210
PE001498R.DLPQGFSALEPLVDLPIGIN[H5N3]ITR.F3,914.866P0DTC2N23430
PE001616K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A5,988.738P0DTC2N107410
PE001515R.EGVFVSN[H5N3]GTHWFVTQR.N3,300.419P0DTC2N109820
PE001789K.N[H5N3]VSDIIPR.T2,350.016Q9BYF1N69010