G37818NZ

From GPTWiki
Revision as of 22:30, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G37818NZ |class=N-Glycan |mw=2953.0473968 |name=H7N6S2 A4G4S2 HexNAc(6)Hex(7)NeuAc(2) |nneuac=2 |sym=H7N6S2 |topo=G36189TM,G77056UT |topo2=G16444FW,G25066B...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H7N6S2
A4G4S2
HexNAc(6)Hex(7)NeuAc(2)
Molecular Weight 2953.0473968
Class(es) N-Glycan
GlyGen

G37818NZ

GNOme

G37818NZ

Topologies

Samples (Peptides)

Human Serum (4 / 5), SARS-CoV-2 Spike Protein (1 / 5)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001097K.VVLHPN[H7N6S2]YSQVDIGLIK.L4,747.051P00738N24110
PE001039K.SVQEIQATFFYFTPN[H7N6S2]KTEDTIFLR.E5,847.496P02763N7250
PE001807R.QDQCIYN[H7N6S2]TTYLNVQR.E4,867.937P02763N93108
PE002206K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6S2]FTTAPAICHDGK.A7,504.273P0DTC2N107410
PE001039K.SVQEIQATFFYFTPN[H7N6S2]KTEDTIFLR.E5,847.496P19652N7250
PE001143R.QNQCFYN[H7N6S2]SSYLNVQR.E4,872.906P19652N9320