G37399XV

From GPTWiki
Revision as of 18:37, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G37399XV |class=N-Glycan |mw=1728.6082159 |name=H5N3S HexNAc(3)Hex(5)NeuAc(1) |nneuac=1 |sym=H5N3S |topo=G41793DV |topo2=G26070RB,G40286QP,G47220PE,G81236O...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H5N3S
HexNAc(3)Hex(5)NeuAc(1)
Molecular Weight 1728.6082159
Class(es) N-Glycan
GlyGen

G37399XV

GNOme

G37399XV

Topologies

Samples (Peptides)

HEK293 Cells (1 / 12), Human Serum (9 / 12), SARS-CoV-2 Spike Protein (2 / 12)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001128R.VFHIHN[H5N3S]ESWVLLTPK.A3,547.586O75882N42832
PE001165K.SLGNVN[H5N3S]FTVSAEALESQELCGTEVPSVPEHGR.K5,141.229P01023N86983
PE001398K.TVLTPATNHMGN[H5N3S]VTFTIPANR.E3,982.761P01024N8510
PE001116R.LSLHRPALEDLLLGSEAN[H5N3S]LTCTLTGLR.D4,691.199P01876N14481
PE001107R.PALEDLLLGSEAN[H5N3S]LTCTLTGLR.D4,084.839P01876N14452
PE001116R.LSLHRPALEDLLLGSEAN[H5N3S]LTCTLTGLR.D4,691.199P01877N13181
PE001107R.PALEDLLLGSEAN[H5N3S]LTCTLTGLR.D4,084.839P01877N13152
PE001474K.N[H5N3S]GSLFAFR.G2,639.074P04004N16910
PE001225K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N3S]GSLFAFR.G9,193.272P04004N16910
PE001364K.FVEGSHN[H5N3S]STVSLTTK.N3,334.408P04114N3411108
PE000993R.VIDFN[H5N3S]CTTSSVSSALANTK.D3,742.576P04196N12510
PE001497R.DLPQGFSALEPLVDLPIGIN[H5N3S]ITR.F4,205.961P0DTC2N23420
PE001607R.EGVFVSN[H5N3S]GTHWFVTQR.N3,591.515P0DTC2N109810
PE002022R.VQPFN[H5N3S]VTQGK.Y2,845.201P13473N35610