G28541PG

From GPTWiki
Revision as of 17:54, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G28541PG |class=N-Glycan |mw=1599.5656228 |name=H6N3 HexNAc(3)Hex(6) |nneuac=0 |sym=H6N3 |topo=G03042JU,G22691IW,G89326DO |topo2=G15399CV,G28185RI,G34259ZA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H6N3
HexNAc(3)Hex(6)
Molecular Weight 1599.5656228
Class(es) N-Glycan
GlyGen

G28541PG

GNOme

G28541PG

Topologies

Samples (Peptides)

HEK293 Cells (2 / 10), Human Serum (3 / 10), NIST IgG Standard (2 / 10), SARS-CoV-2 Spike Protein (3 / 10)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001127R.VFHIHN[H6N3]ESWVLLTPK.A3,418.544O75882N42871
PE001068K.SLGNVN[H6N3]FTVSAEALESQELCGTEVPSVPEHGR.K5,012.186P01023N86950
PE000939R.EEQYN[H6N3]STYR.V2,788.070P01857N18070
PE000949K.TKPREEQYN[H6N3]STYR.V3,270.367P01857N180100
PE001059R.LSLHRPALEDLLLGSEAN[H6N3]LTCTLTGLR.D4,562.157P01876N14421
PE001059R.LSLHRPALEDLLLGSEAN[H6N3]LTCTLTGLR.D4,562.157P01877N13121
PE001495R.DLPQGFSALEPLVDLPIGIN[H6N3]ITR.F4,076.919P0DTC2N23430
PE001544K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N3]FTTAPAICHDGK.A6,150.791P0DTC2N107420
PE001513R.EGVFVSN[H6N3]GTHWFVTQR.N3,462.472P0DTC2N109820
PE001909R.GHTLTLN[H6N3]FTR.N2,758.180P11279N10320
PE001903K.GN[H6N3]ETIVNLIHSTR.I3,052.334P16870N13910