TR030750

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A (PE001616)
Prec. m/z 853.971
Prec. z 7+
Prod. m/z 992.487
Prod. z 5+
Label Y[pN2]
Trans. Group(s) TG004234