TR030711

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Prec. m/z 993.465
Prec. z 6+
Prod. m/z 966.457
Prod. z 6+
Label Y[pH3N3F]
Trans. Group(s) TG004183