TR030540

From GPTWiki
Jump to navigation Jump to search
Peptide K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N4F]VTAR.N (PE002178)
Prec. m/z 1309.809
Prec. z 5+
Prod. m/z 1545.726
Prod. z 4+
Label Y[pH4N3F]
Trans. Group(s) TG006379