TR025574

From GPTWiki
Jump to navigation Jump to search
Peptide K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I (PE001836)
Prec. m/z 1401.448
Prec. z 5+
Prod. m/z 1843.573
Prod. z 3+
Label Y[pH2N2]
Trans. Group(s) TG005105