TR025570

From GPTWiki
Jump to navigation Jump to search
Peptide K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I (PE001836)
Prec. m/z 1401.448
Prec. z 5+
Prod. m/z 1546.988
Prod. z 4+
Label Y[pH3N3S]
Trans. Group(s) TG005105