TR024506

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4F]STEAGQK.L (PE001774)
Prec. m/z 968.103
Prec. z 6+
Prod. m/z 1269.084
Prod. z 4+
Label Y[pH3N2F]*
Trans. Group(s) TG004678