TR024505

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L (PE001773)
Prec. m/z 880.239
Prec. z 6+
Prod. m/z 950.648
Prod. z 5+
Label Y[pHN2F]
Trans. Group(s) TG004698