TR024474

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Prec. m/z 914.085
Prec. z 6+
Prod. m/z 1413.344
Prod. z 3+
Label Y[pN]
Trans. Group(s) TG004726, TG004775