TR024464

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Prec. m/z 1096.701
Prec. z 5+
Prod. m/z 1583.741
Prod. z 3+
Label Y[pHN2F]*
Trans. Group(s) TG004713