TR024461

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Prec. m/z 1096.701
Prec. z 5+
Prod. m/z 1096.775
Prod. z 4+
Label Y[pNF]*
Trans. Group(s) TG004713