TR024428

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L (PE001770)
Prec. m/z 1016.619
Prec. z 6+
Prod. m/z 1111.030
Prod. z 4+
Label Y[pN2]
Trans. Group(s) TG004670