TR024412

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L (PE001770)
Prec. m/z 1016.619
Prec. z 6+
Prod. m/z 1413.344
Prod. z 3+
Label Y[pN]
Trans. Group(s) TG004670