TR024387

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L (PE001769)
Prec. m/z 855.896
Prec. z 6+
Prod. m/z 953.847
Prod. z 5+
Label Y[pH2N2]
Trans. Group(s) TG004655