TR022767

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A (PE001616)
Prec. m/z 853.971
Prec. z 7+
Prod. m/z 830.820
Prod. z 7+
Label Y[pH4N3]
Trans. Group(s) TG004234