TR022756

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Prec. m/z 851.686
Prec. z 7+
Prod. m/z 905.601
Prod. z 6+
Label Y[pH2N2F]*
Trans. Group(s) TG004196