TR022135

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A (PE001556)
Prec. m/z 1034.150
Prec. z 6+
Prod. m/z 1280.870
Prod. z 4+
Label Y[pHN2]
Trans. Group(s) TG004106