TR022131

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A (PE001556)
Prec. m/z 1034.150
Prec. z 6+
Prod. m/z 1167.752
Prod. z 5+
Label Y[pH2N4F]
Trans. Group(s) TG004106