TR022110

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A (PE001554)
Prec. m/z 1454.448
Prec. z 5+
Prod. m/z 1540.464
Prod. z 4+
Label Y[pH4N4F]
Trans. Group(s) TG004174, TG004246