TR022079

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4F]FTTAPAICHDGK.A (PE001553)
Prec. m/z 1054.321
Prec. z 6+
Prod. m/z 1159.546
Prod. z 5+
Label Y[pH3N3F]
Trans. Group(s) TG004164