TR022063

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N6F]FTTAPAICHDGK.A (PE001551)
Prec. m/z 961.870
Prec. z 7+
Prod. m/z 1179.156
Prod. z 5+
Label Y[pH2N5]*
Trans. Group(s) TG004097, TG004281