TR017297

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Prec. m/z 1500.660
Prec. z 5+
Prod. m/z 1211.093
Prod. z 4+
Label Y[pN]
Trans. Group(s) TG002782, TG003436, TG005081