TR016768

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N (PE000438)
Prec. m/z 1372.614
Prec. z 5+
Prod. m/z 1569.968
Prod. z 4+
Label Y[pH5N4]
Trans. Group(s) TG000395