TR007164

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1173.302
Prec. z 8+
Prod. m/z 1288.611
Prod. z 7+
Label Y[pH4N3S]
Trans. Group(s)