TR007162

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1173.302
Prec. z 8+
Prod. m/z 1116.658
Prod. z 8+
Label Y[pH4N4]
Trans. Group(s) TG001125