TR007160

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1340.773
Prec. z 7+
Prod. m/z 1534.559
Prod. z 5+
Label Y[pN]
Trans. Group(s) TG001136