TR007158

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1340.773
Prec. z 7+
Prod. m/z 1427.687
Prod. z 6+
Label Y[pH3N3]
Trans. Group(s) TG001136