TR002989

From GPTWiki
Jump to navigation Jump to search
Peptide K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S (PE000162)
Prec. m/z 1619.852
Prec. z 6+
Prod. m/z 1412.037
Prod. z 5+
Label Y[pN]
Trans. Group(s) TG000397