TR002054

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4FS2]TTLTEILK.G (PE000234)
Prec. m/z 1303.846
Prec. z 5+
Prod. m/z 1505.174
Prod. z 3+
Label Y[pNF]*
Trans. Group(s)