TR002048

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G (PE000253)
Prec. m/z 879.053
Prec. z 8+
Prod. m/z 1524.181
Prod. z 3+
Label Y[pN2]
Trans. Group(s)