TR002033

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G (PE000253)
Prec. m/z 1004.488
Prec. z 7+
Prod. m/z 1224.414
Prod. z 4+
Label Y[pH2N2]
Trans. Group(s)