TR002032

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G (PE000253)
Prec. m/z 1004.488
Prec. z 7+
Prod. m/z 1093.375
Prod. z 5+
Label Y[pH3N4]
Trans. Group(s)