TR002029

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G (PE000253)
Prec. m/z 1004.488
Prec. z 7+
Prod. m/z 1686.234
Prod. z 3+
Label Y[pH3N2]
Trans. Group(s)