TR002024

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H6N5S3]TTLTEILK.G (PE000253)
Prec. m/z 1171.735
Prec. z 6+
Prod. m/z 1457.750
Prod. z 4+
Label Y[pH4N5]
Trans. Group(s)