TR002009

From GPTWiki
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G (PE000243)
Prec. m/z 910.741
Prec. z 7+
Prod. m/z 1092.618
Prod. z 4+
Label Y[pN]
Trans. Group(s) TG000369