TR001546

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1173.302
Prec. z 8+
Prod. m/z 1171.714
Prod. z 7+
Label Y[pH2N2]
Trans. Group(s) TG000265, TG001125