TR001166

From GPTWiki
Jump to navigation Jump to search
Peptide R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5F]LTHLPANLLQGASK.L (PE000345)
Prec. m/z 1407.451
Prec. z 5+
Prod. m/z 1276.389
Prod. z 4+
Label Y[pN]
Trans. Group(s)