TG010718

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 204284.000
Score 2.374
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
54.574 54.574 166.963 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 100.0
54.574 54.574 166.963 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 74.9
54.574 54.574 166.963 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 63.8
54.574 54.574 166.963 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 34.3
54.574 54.574 166.963 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 12.2
54.574 54.574 166.963 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 10.2
54.574 54.574 166.963 1,437.158 4+ 1,248.644 3+ Y[pN] 9.8
54.574 54.574 166.963 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 9.7
54.574 54.574 166.963 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 6.8
54.574 54.574 166.963 1,437.158 4+ 1,478.390 3+ Y[pH3N2] 6.4
54.574 54.574 166.963 1,437.158 4+ 1,316.337 3+ Y[pN2] 3.5
54.574 54.574 166.963 1,437.158 4+ 1,872.463 2+ Y[pN] 3.0
54.574 54.574 166.963 1,437.158 4+ 1,370.355 3+ Y[pHN2] 1.3