TG010652

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 47662.600
Score 2.122
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
62.725 62.725 204.755 1,081.287 5+ 1,187.300 4+ Y[pH4N3S] 100.0
62.725 62.725 204.755 1,081.287 5+ 1,278.583 4+ Y[pH5N4S] 51.8
62.725 62.725 204.755 1,081.287 5+ 1,363.988 3+ Y[pH3N2] 28.0
62.725 62.725 204.755 1,081.287 5+ 1,485.699 3+ Y[pH4N3] 27.7
62.725 62.725 204.755 1,081.287 5+ 1,114.526 4+ Y[pH4N3] 26.1
62.725 62.725 204.755 1,081.287 5+ 1,700.859 2+ Y[pN] 21.3
62.725 62.725 204.755 1,081.287 5+ 1,205.809 4+ Y[pH5N4] 16.1
62.725 62.725 204.755 1,081.287 5+ 1,146.786 4+ Y[pH3N3S] 14.2