TG010595

From GPTWiki
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 54241.300
Score 3.637
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.061 59.061 187.767 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
59.061 59.061 187.767 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 14.4
59.061 59.061 187.767 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 11.5
59.061 59.061 187.767 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 10.1
59.061 59.061 187.767 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 8.8
59.061 59.061 187.767 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 6.8
59.061 59.061 187.767 1,433.161 4+ 1,352.135 4+ Y[pH7N2] 6.1
59.061 59.061 187.767 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 6.1
59.061 59.061 187.767 1,433.161 4+ 1,424.387 3+ Y[pN2] 5.6
59.061 59.061 187.767 1,433.161 4+ 1,109.056 4+ Y[pHN2] 5.2
59.061 59.061 187.767 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 5.2
59.061 59.061 187.767 1,433.161 4+ 1,478.405 3+ Y[pHN2] 4.5
59.061 59.061 187.767 1,433.161 4+ 1,068.542 4+ Y[pN2] 2.5
59.061 59.061 187.767 1,433.161 4+ 1,289.001 3+ Y[p] 2.2