TG010186

From GPTWiki
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 84376.700
Score 5.066
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
56.733 56.733 177.018 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
56.733 56.733 177.018 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 14.4
56.733 56.733 177.018 1,433.161 4+ 1,424.387 3+ Y[pN2] 14.1
56.733 56.733 177.018 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 12.0
56.733 56.733 177.018 1,433.161 4+ 1,478.405 3+ Y[pHN2] 12.0
56.733 56.733 177.018 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 10.9
56.733 56.733 177.018 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 9.4
56.733 56.733 177.018 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 8.7
56.733 56.733 177.018 1,433.161 4+ 1,352.135 4+ Y[pH7N2] 7.9
56.733 56.733 177.018 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 6.8
56.733 56.733 177.018 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 6.0
56.733 56.733 177.018 1,433.161 4+ 1,109.056 4+ Y[pHN2] 5.5
56.733 56.733 177.018 1,433.161 4+ 1,068.542 4+ Y[pN2] 2.5
56.733 56.733 177.018 1,433.161 4+ 1,289.001 3+ Y[p] 2.3