TG010073

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 85005.100
Score 3.402
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
61.312 61.312 198.132 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 100.0
61.312 61.312 198.132 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 96.7
61.312 61.312 198.132 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 68.0
61.312 61.312 198.132 1,351.357 4+ 1,700.859 2+ Y[pN] 36.7
61.312 61.312 198.132 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 31.8
61.312 61.312 198.132 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 31.1
61.312 61.312 198.132 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 31.0
61.312 61.312 198.132 1,351.357 4+ 1,205.809 4+ Y[pH5N4] 14.3