TG009884

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 587484.000
Score 3.481
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.444 52.444 161.474 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 100.0
52.444 52.444 161.474 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 93.2
52.444 52.444 161.474 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 81.0
52.444 52.444 161.474 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 44.3
52.444 52.444 161.474 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 30.2
52.444 52.444 161.474 1,437.158 4+ 1,248.644 3+ Y[pN] 17.5
52.444 52.444 161.474 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 13.4
52.444 52.444 161.474 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 12.9
52.444 52.444 161.474 1,437.158 4+ 1,872.463 2+ Y[pN] 12.1
52.444 52.444 161.474 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 9.2
52.444 52.444 161.474 1,437.158 4+ 1,478.390 3+ Y[pH3N2] 9.0
52.444 52.444 161.474 1,437.158 4+ 1,316.337 3+ Y[pN2] 4.6
52.444 52.444 161.474 1,437.158 4+ 1,370.355 3+ Y[pHN2] 2.5