TG009660

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 30118.500
Score 4.216
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.831 35.831 80.549 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 100.0
35.831 35.831 80.549 1,240.319 5+ 1,313.316 4+ Y[pH4N3] 52.3
35.831 35.831 80.549 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 43.1
35.831 35.831 80.549 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 34.3
35.831 35.831 80.549 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 25.2
35.831 35.831 80.549 1,240.319 5+ 1,049.724 4+ Y[pN] 24.9
35.831 35.831 80.549 1,240.319 5+ 1,399.295 3+ Y[pN] 24.7
35.831 35.831 80.549 1,240.319 5+ 1,477.373 4+ Y[pH5N4S] 17.7
35.831 35.831 80.549 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 13.9
35.831 35.831 80.549 1,240.319 5+ 1,404.599 4+ Y[pH5N4] 10.9
35.831 35.831 80.549 1,240.319 5+ 1,696.734 3+ Y[pH3N3] 9.5
35.831 35.831 80.549 1,240.319 5+ 1,521.006 3+ Y[pHN2] 7.8
35.831 35.831 80.549 1,240.319 5+ 1,466.989 3+ Y[pN2] 1.4